Chorismate mutase
Ligand-induced domain movement details

Jmol view of liganded conformation 1

Domain Movement

domain 1 is binding domain(fixed in space) domain 2 is binding domain(fixed in space)

Sequence


           _________________________________69_______________ 
 2fp2(B) : **SQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDA 
         :                                                    
 2ao2(B) : GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDA 
           _________________________________69_______________ 

           ____90____________________________________________ 
 2fp2(B) : RSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASR 
         :                                                    
 2ao2(B) : RSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASR 
           ____90____________________________________________ 

           __________________________________________________ 
 2fp2(B) : SAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRA 
         :                                                    
 2ao2(B) : SAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRA 
           __________________________________________________ 

           _______________                                    
 2fp2(B) : LTTATQSYCQALPPA                                    
         :                                                    
 2ao2(B) : LTTATQSYCQALPPA                                    
           _______________                                    

Details

  Property   Value
 Conformer 1 2fp2(B)
 Conformer 2 2ao2(B)
 Radius gyration for conformer 1 16.2 A
 Radius gyration for conformer 2 16.28 A
 EC Number 5.4.99.5  
Click here to see the DynDom results or the famliy
 Trigger ligands TSA500
 Trigger ligands in which conformation Conformation  1
 Conformaton with trigger ligands is compact Yes
 Spanning ligands Yes
 Residues in enzyme contacting ligands ARG134  ARG49  ARG72  ASP69  GLN76  GLU106  GLU109  GLU68  ILE102  ILE67  LYS60  THR105  VAL56  VAL73 
 Residues in extended bending regions contacting ligands ARG72  ASP69  GLU68  ILE67  VAL73 
 Residues in extended bending regions making H-bonds or salt-bridges with ligands ASP69  ILE67 
  Residues in extended bending regions with an H-bond between its main chain and ligands ASP69  ILE67 
Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT