GUANYLATE KINASE
Ligand-induced domain movement details

Jmol view of liganded conformation 2

Domain Movement

domain 1 is binding domain(fixed in space)	domain 2 is binding domain(fixed in space)

Sequence

__________________________229_____________________   1ex6(B) : SRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDY           :                                                      1ex7(A) : SRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDY             ___________________________29_____________________             ________________________________285_______________   1ex6(B) : NFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDID           :                                                      1ex7(A) : NFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDID             _________________________________85_______________             __________________________________________________   1ex6(B) : MQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAA           :                                                      1ex7(A) : MQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAA             __________________________________________________             ____________________________________                 1ex6(B) : QAELAYAETGAHDKVIVNDDLDKAYKELKDFIFAEK                         :                                                      1ex7(A) : QAELAYAETGAHDKVIVNDDLDKAYKELKDFIFAEK                           ____________________________________

Details

Property   Value  Conformer 1 1ex6(B)  Conformer 2 1ex7(A)  Radius gyration for conformer 1 17.69 A  Radius gyration for conformer 2 16.51 A  EC Number 2.7.4.8   Click here to see the DynDom results or the famliy  Trigger ligands 5GP187  Trigger ligands in which conformation Conformation  2  Conformaton with trigger ligands is compact Yes  Spanning ligands Yes  Residues in enzyme contacting ligands ARG38  ARG41  ASP100  ASP98  GLU69  GLY103  GLY79  ILE99  PHE73  SER34  SER80  TYR50  TYR78   Residues in extended bending regions contacting ligands SER34   Residues in extended bending regions making H-bonds or salt-bridges with ligands SER34    Residues in extended bending regions with an H-bond between its main chain and ligands Null Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT