Undecaprenyl pyrophosphate synthetase
Ligand-induced domain movement details

Jmol view of liganded conformation 1

Domain Movement

domain 1 is binding domain(fixed in space)	domain 2 is binding domain(fixed in space)

Sequence

__________________________________________________   1x09(A) : LSEKLPAHGCRHVAIIMAGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAA           :                                                      1jp3(B) : ********GCRHVAII-dGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAA             __________________________________________________             ______66__________________________________________   1x09(A) : NNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLR           :                                                      1jp3(B) : NNGIEALTLYAFSsA------------LeLFVWALDSEVKSLHRHNVRLR             ______66__________________________________________             ______________________________141_________________   1x09(A) : IIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQL           :                                                      1jp3(B) : IIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQL             ______________________________141_________________             __________________________________________________   1x09(A) : AEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQ           :                                                      1jp3(B) : AEKVQQGNLQPDQIDEE-lNQHVC-hELAPVDLVIRTGGEHRISNFLLWQ             __________________________________________________             _______________________________                      1x09(A) : IAYAELYFTDVLWPDFDEQDFEGALNAFANR                              :                                                      1jp3(B) : IAYAELYFTDVLWPDFDEQDFEGALNAFAN*                                _______________________________

Details

Property   Value  Conformer 1 1x09(A)  Conformer 2 1jp3(B)  Radius gyration for conformer 1 17.85 A  Radius gyration for conformer 2 18.05 A  EC Number 2.5.1.31   Click here to see the DynDom results or the famliy  Trigger ligands IPE902  Trigger ligands in which conformation Conformation  1  Conformaton with trigger ligands is compact Yes  Spanning ligands Yes  Residues in enzyme contacting ligands ALA26  ALA69  ARG194  ARG200  ARG77  ASN74  ILE24  MET25  PHE70  SER202  TYR68   Residues in extended bending regions contacting ligands ALA69  ASN74  PHE70  TYR68   Residues in extended bending regions making H-bonds or salt-bridges with ligands ASN74    Residues in extended bending regions with an H-bond between its main chain and ligands Null Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT